(data stored in ACNUC30630 zone)

EMBL: CP001515.PE30

CP001515.PE30        Location/Qualifiers
FT   CDS             32673..33755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45428"
FT                   /protein_id="ACS45428.1"
FT                   /translation="MAGKEKIDVRILRYTENGQKRYMAASCLLVLILSIVNAYVHEIEY
FT                   MLRKKEYNYSWSELYNYFIDFYPNVNSPFSLLLELFSFLSTLAIALAVVVEGEGKMLIL
FT                   SKFSYWLCVGSCSVLAVMSRALFSGLGVIKAIAVIVSSIIILYYLGRFSIVIGQKNFIN
FT                   ARMAFDKSVSLIYLKLYERYGGERSAARSLVKVFVLLSILLIMAIGPWVLLITDALSAT
FT                   RYDNGNILSVLLVFLFIYCLTFVALLKNEEHGMNGLLLVTSCFVPLLPLLFYVFHSIHN
FT                   SIHYVIIFFIALSLSFWSLFCVACSRMSSGELSEKLRKRRPWILVAEIESIHSIKARLY
FT                   MKIHLKYIDRVEYMNGLGGS"
     MAGKEKIDVR ILRYTENGQK RYMAASCLLV LILSIVNAYV HEIEYMLRKK EYNYSWSELY        60
     NYFIDFYPNV NSPFSLLLEL FSFLSTLAIA LAVVVEGEGK MLILSKFSYW LCVGSCSVLA       120
     VMSRALFSGL GVIKAIAVIV SSIIILYYLG RFSIVIGQKN FINARMAFDK SVSLIYLKLY       180
     ERYGGERSAA RSLVKVFVLL SILLIMAIGP WVLLITDALS ATRYDNGNIL SVLLVFLFIY       240
     CLTFVALLKN EEHGMNGLLL VTSCFVPLLP LLFYVFHSIH NSIHYVIIFF IALSLSFWSL       300
     FCVACSRMSS GELSEKLRKR RPWILVAEIE SIHSIKARLY MKIHLKYIDR VEYMNGLGGS       360
//

If you have problems or comments...

PBIL Back to PBIL home page