(data stored in ACNUC30630 zone)

EMBL: CP001515.PE324

CP001515.PE324       Location/Qualifiers
FT   CDS             415868..417586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0335"
FT                   /product="hypothetical protein"
FT                   /note="COG3599 Cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45722"
FT                   /protein_id="ACS45722.1"
FT                   /translation="MVDRFPVVLRGYDKERVDEAMLAAQNSIDRLREQVKAGDDTVLQL
FT                   QAQLQEEKNRKANTDNSFASLGANAQQMLASAEQTSTELLERAKKDAASARTEAQSQSQ
FT                   TLVNNAKLDAQHLVDDAQAKADTILKNAQSEANTIVTNARQEAEQLRASTAKTVSDQRQ
FT                   ALDLELTNSREEHKKRLASERAQQERELADLSAQTAKTISEQRKSANEEMARLKSETND
FT                   QIETALADANKKLADVREQVSKLMTEAQRKAGEITDAAKAHAQEITDAAEVNRTQTMSQ
FT                   VNAEVEQIRADIAAQQDEATKKVQELLQSLEESRKSAKEEAEKEIGQAKQAREEADAYA
FT                   AEKRESADTEAREIVRKAGEEASKQIEDRRKAAQSELDGLRKRIGELQTREADITQRVS
FT                   ELRSMFANAFAGFGFGIDKHSTDTMSVVNTVAGDNDSSDTPQAPADNGSVRSDLANTML
FT                   INPSDSAQHEASHPMSHVTVPVAPALHDHAAQANAADDDNAGTNDEAQVPAVDIPADPN
FT                   TPSPEAPEAPAASAAEVMEAIDGDEPISDDTHVTGDADSLFDSSDNMPVAPNNEQ"
     MVDRFPVVLR GYDKERVDEA MLAAQNSIDR LREQVKAGDD TVLQLQAQLQ EEKNRKANTD        60
     NSFASLGANA QQMLASAEQT STELLERAKK DAASARTEAQ SQSQTLVNNA KLDAQHLVDD       120
     AQAKADTILK NAQSEANTIV TNARQEAEQL RASTAKTVSD QRQALDLELT NSREEHKKRL       180
     ASERAQQERE LADLSAQTAK TISEQRKSAN EEMARLKSET NDQIETALAD ANKKLADVRE       240
     QVSKLMTEAQ RKAGEITDAA KAHAQEITDA AEVNRTQTMS QVNAEVEQIR ADIAAQQDEA       300
     TKKVQELLQS LEESRKSAKE EAEKEIGQAK QAREEADAYA AEKRESADTE AREIVRKAGE       360
     EASKQIEDRR KAAQSELDGL RKRIGELQTR EADITQRVSE LRSMFANAFA GFGFGIDKHS       420
     TDTMSVVNTV AGDNDSSDTP QAPADNGSVR SDLANTMLIN PSDSAQHEAS HPMSHVTVPV       480
     APALHDHAAQ ANAADDDNAG TNDEAQVPAV DIPADPNTPS PEAPEAPAAS AAEVMEAIDG       540
     DEPISDDTHV TGDADSLFDS SDNMPVAPNN EQ                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page