(data stored in ACNUC30630 zone)

EMBL: CP001515.PE330

CP001515.PE330       Location/Qualifiers
FT   CDS             425050..426273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0341"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45728"
FT                   /protein_id="ACS45728.1"
FT                   /translation="MTPGEIAMAIAMGVLLIAGGYAIAYRAGRNREREREPSEAALFAG
FT                   HADADAVDGERRMLAMLEEAVIVTDSSANVLVANEAAIERGLSVDGLIVDAGIRDLVQE
FT                   AAQSDAAVERELELARDSQRLHVAVTAQCTADDRVTVVCADTGYRRSVDRVRRDFVTNV
FT                   SHELKTPVGAIMLLAETIDDAGDDVDMIRHFAARIGVEAKRLDGLVRRLIELGRMHGDR
FT                   ATTRRTVDARELVRQAIIDTEVTAGARHTMVRMRDDAGENHPLPVTVDAAAVHIALKNL
FT                   VENAINYSPEHAEVTVEVSRGEDQARIRVVDHGIGIPRQLQGRIFERFYRVDPARSRLT
FT                   GGTGLGLSIASHHILANQGKLEVWSKPGEGSTFTVMLPLAMRDDDTPCNRDADAEGDPD
FT                   GTGKEADR"
     MTPGEIAMAI AMGVLLIAGG YAIAYRAGRN REREREPSEA ALFAGHADAD AVDGERRMLA        60
     MLEEAVIVTD SSANVLVANE AAIERGLSVD GLIVDAGIRD LVQEAAQSDA AVERELELAR       120
     DSQRLHVAVT AQCTADDRVT VVCADTGYRR SVDRVRRDFV TNVSHELKTP VGAIMLLAET       180
     IDDAGDDVDM IRHFAARIGV EAKRLDGLVR RLIELGRMHG DRATTRRTVD ARELVRQAII       240
     DTEVTAGARH TMVRMRDDAG ENHPLPVTVD AAAVHIALKN LVENAINYSP EHAEVTVEVS       300
     RGEDQARIRV VDHGIGIPRQ LQGRIFERFY RVDPARSRLT GGTGLGLSIA SHHILANQGK       360
     LEVWSKPGEG STFTVMLPLA MRDDDTPCNR DADAEGDPDG TGKEADR                     407
//

If you have problems or comments...

PBIL Back to PBIL home page