(data stored in ACNUC30630 zone)

EMBL: CP001515.PE361

CP001515.PE361       Location/Qualifiers
FT   CDS             complement(459345..462041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0376"
FT                   /product="glycogen operon protein GlgX"
FT                   /note="COG1523 Type II secretory pathway, pullulanase PulA
FT                   and related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45759"
FT                   /protein_id="ACS45759.1"
FT                   /translation="MQLQKLQRYATRPGFFYTDDGGADVVVRSETAEQLWLSVLEPVDK
FT                   PSAFYNQAVRLPDDAADRLLDYMRHYPICSRIVPALGLRETLFKMTGPNYGLWNLHLDK
FT                   AWDGLQYGFRADGTWDPHHGLRFNPYKFLIDPYAKGIERAMQLDPSMFAYQCTIGDDGK
FT                   VEGDSWGEMSTLDSLGHCPVSVAIDDRDARKHDGDPEHPHVPWSKTVIYELHVKGFTKN
FT                   APWLPEELRGTYAGLAHPTTLAYLQDLGVTSIELLPIMAKQPEVFLQERVRTNYWGYST
FT                   LNFFSPEPGYATKKAQQAGAAAVRREVIDMVRALHESGFEVIMDVVYNHTCEGGNAGPS
FT                   VCWRGLDNLSFYRQQTQHAGELEDTTGCGNTVDFTDTHNITFAVDSLRYWAKRIGIDGF
FT                   RFDLAVSLARLKGMFTPYHPFLYALRSDQLLGNLKLIMEPWDLGFQGWRTGQFLSPFGE
FT                   WNDRFRDASRQFWLSDINQTAGHGVTTMQEMATRLCGSADLFATDPGRGATSSINYISA
FT                   HDGFTLADLTSYDHKHNEANGENNNDGTNVNHSANFGVEGPTDDLSIESARERSRMNML
FT                   GTLILSLGTPMLLAGDEFGNTQYGNNNAYCQDNEIAWLDWDWINCTEETAESRQLEATA
FT                   NLIAVRKSLDIYNHEDFFTRLSQLGLLKPSSRVQWSLPDGTMPMDSDWRDPSVRSFMMH
FT                   LYFKDEPDALIVVNGDETDRRMHLPSDSTFNLLWSSAQTTGEQPAPGTSVTKILRSAAV
FT                   SPLAETLRFKRATSPLHDLDAHGAVGADAEENAARQEIGTTKPTAKLTAHETQLLESIL
FT                   DRKIKDTLDQQMPPMTAGAHSGTGDPTRISMADSDPTTTAFDVEHDAPTPEDTAPAAGS
FT                   PNAVPSNVWTFPALSISLLLQSERRSW"
     MQLQKLQRYA TRPGFFYTDD GGADVVVRSE TAEQLWLSVL EPVDKPSAFY NQAVRLPDDA        60
     ADRLLDYMRH YPICSRIVPA LGLRETLFKM TGPNYGLWNL HLDKAWDGLQ YGFRADGTWD       120
     PHHGLRFNPY KFLIDPYAKG IERAMQLDPS MFAYQCTIGD DGKVEGDSWG EMSTLDSLGH       180
     CPVSVAIDDR DARKHDGDPE HPHVPWSKTV IYELHVKGFT KNAPWLPEEL RGTYAGLAHP       240
     TTLAYLQDLG VTSIELLPIM AKQPEVFLQE RVRTNYWGYS TLNFFSPEPG YATKKAQQAG       300
     AAAVRREVID MVRALHESGF EVIMDVVYNH TCEGGNAGPS VCWRGLDNLS FYRQQTQHAG       360
     ELEDTTGCGN TVDFTDTHNI TFAVDSLRYW AKRIGIDGFR FDLAVSLARL KGMFTPYHPF       420
     LYALRSDQLL GNLKLIMEPW DLGFQGWRTG QFLSPFGEWN DRFRDASRQF WLSDINQTAG       480
     HGVTTMQEMA TRLCGSADLF ATDPGRGATS SINYISAHDG FTLADLTSYD HKHNEANGEN       540
     NNDGTNVNHS ANFGVEGPTD DLSIESARER SRMNMLGTLI LSLGTPMLLA GDEFGNTQYG       600
     NNNAYCQDNE IAWLDWDWIN CTEETAESRQ LEATANLIAV RKSLDIYNHE DFFTRLSQLG       660
     LLKPSSRVQW SLPDGTMPMD SDWRDPSVRS FMMHLYFKDE PDALIVVNGD ETDRRMHLPS       720
     DSTFNLLWSS AQTTGEQPAP GTSVTKILRS AAVSPLAETL RFKRATSPLH DLDAHGAVGA       780
     DAEENAARQE IGTTKPTAKL TAHETQLLES ILDRKIKDTL DQQMPPMTAG AHSGTGDPTR       840
     ISMADSDPTT TAFDVEHDAP TPEDTAPAAG SPNAVPSNVW TFPALSISLL LQSERRSW         898
//

If you have problems or comments...

PBIL Back to PBIL home page