(data stored in ACNUC30630 zone)

EMBL: CP001515.PE393

CP001515.PE393       Location/Qualifiers
FT   CDS             482490..483485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0408"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0202 DNA-directed RNA polymerase, alpha subunit/
FT                   40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45791"
FT                   /protein_id="ACS45791.1"
FT                   /translation="MLIAQRPTLTEESLNPQRSRFIIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSVRISGALHEFTTLPGIEEDVTEILLNIKGIVLTSEYDEPVVMYLRKAGSGE
FT                   ATAGDITPPAGVTIANPDLHIATLAEDGELEIEFTVERGRGYVPAQMNKQDGDEIGRIP
FT                   VDSIYSPVLKVSYKVEATRVEQRTDFDKLILDVETKPAISPRDAVASAGSTLVELFGLC
FT                   RELNTQAEGVEIGPAPVAEQADPGMSVPIEDLNLTQRSYNCLKREGIHTVGELVNHTEQ
FT                   DLLDIRNFGMKSIDEVKEKLQSLGLSLKSSPLGFDTNNLEGGTFFSPEDE"
     MLIAQRPTLT EESLNPQRSR FIIEPLEPGF GYTLGNSLRR TLLSSIPGAA VTSVRISGAL        60
     HEFTTLPGIE EDVTEILLNI KGIVLTSEYD EPVVMYLRKA GSGEATAGDI TPPAGVTIAN       120
     PDLHIATLAE DGELEIEFTV ERGRGYVPAQ MNKQDGDEIG RIPVDSIYSP VLKVSYKVEA       180
     TRVEQRTDFD KLILDVETKP AISPRDAVAS AGSTLVELFG LCRELNTQAE GVEIGPAPVA       240
     EQADPGMSVP IEDLNLTQRS YNCLKREGIH TVGELVNHTE QDLLDIRNFG MKSIDEVKEK       300
     LQSLGLSLKS SPLGFDTNNL EGGTFFSPED E                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page