(data stored in ACNUC30630 zone)

EMBL: CP001515.PE396

CP001515.PE396       Location/Qualifiers
FT   CDS             complement(485393..486304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45794"
FT                   /protein_id="ACS45794.1"
FT                   /translation="MQTRHRFLSVCARTVAVALTTLAFVGVTACSAPRIAGRSEQEQEL
FT                   GTCERFLETAQSYSNTMGDANIPLYLRYFTASLAQHDWLNVALQCPSQFGDATMRSAQA
FT                   QHFTRLAANHFGFAYAPLTVTKLDTVDSLDLPGEALATIALAEDRAGFAAEVLAGRYDS
FT                   FTPTSANTSSDAEFVRRLASNATLLTMSDNHKEAAARLTMLSKGAQDIRRKVYDTRMLT
FT                   TSEVNATDPATGLRTRTPAIVEMDCAREQLQRIDDLPASDIATAQSQSSDALLQLSLLI
FT                   ATHAVTAFGLGYPSADYALFAS"
     MQTRHRFLSV CARTVAVALT TLAFVGVTAC SAPRIAGRSE QEQELGTCER FLETAQSYSN        60
     TMGDANIPLY LRYFTASLAQ HDWLNVALQC PSQFGDATMR SAQAQHFTRL AANHFGFAYA       120
     PLTVTKLDTV DSLDLPGEAL ATIALAEDRA GFAAEVLAGR YDSFTPTSAN TSSDAEFVRR       180
     LASNATLLTM SDNHKEAAAR LTMLSKGAQD IRRKVYDTRM LTTSEVNATD PATGLRTRTP       240
     AIVEMDCARE QLQRIDDLPA SDIATAQSQS SDALLQLSLL IATHAVTAFG LGYPSADYAL       300
     FAS                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page