(data stored in ACNUC30630 zone)

EMBL: CP001515.PE401

CP001515.PE401       Location/Qualifiers
FT   CDS             492408..493694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0417"
FT                   /product="riboflavin kinase"
FT                   /note="COG0196 FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45799"
FT                   /protein_id="ACS45799.1"
FT                   /translation="MDIFRLTPAADGNVAWPTLSTSKKSVVTVGAFDGLHVGHHAVIEE
FT                   TVRQARKLDAYSVVIMFDPRPAFVHAYAKAHAGKDVPAGVHDPEAITGVDARLRMLSRM
FT                   HVDYVLIVRYTIAFSEKSFRFFLGQLVGKLGMRMLVLGEDARMGANLEGDIKKIRTLAE
FT                   ATGVFELEVVTNQGGTVRVPERFTPTAPNEPGEPGDPLEGLGKAERRAWSKKHNAREVR
FT                   NQSSTNVRYLLSQGRVQAANEILGHAHAVEGVVEHGEERGRTIGFPTANIAEPMEGYLP
FT                   VDGVYAGWLVDLGPADEYERDQQQLSGKAADGEAVEAASVTVSDTPVVSHRFSSSRVDS
FT                   RLAAQSPFRWPAAISIGTKPTYSESTGLNERVLEAYALTDEWLDLYGHRVRVEFERFLR
FT                   PQIKFGSTDELVAELKHNVEETKELLGAE"
     MDIFRLTPAA DGNVAWPTLS TSKKSVVTVG AFDGLHVGHH AVIEETVRQA RKLDAYSVVI        60
     MFDPRPAFVH AYAKAHAGKD VPAGVHDPEA ITGVDARLRM LSRMHVDYVL IVRYTIAFSE       120
     KSFRFFLGQL VGKLGMRMLV LGEDARMGAN LEGDIKKIRT LAEATGVFEL EVVTNQGGTV       180
     RVPERFTPTA PNEPGEPGDP LEGLGKAERR AWSKKHNARE VRNQSSTNVR YLLSQGRVQA       240
     ANEILGHAHA VEGVVEHGEE RGRTIGFPTA NIAEPMEGYL PVDGVYAGWL VDLGPADEYE       300
     RDQQQLSGKA ADGEAVEAAS VTVSDTPVVS HRFSSSRVDS RLAAQSPFRW PAAISIGTKP       360
     TYSESTGLNE RVLEAYALTD EWLDLYGHRV RVEFERFLRP QIKFGSTDEL VAELKHNVEE       420
     TKELLGAE                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page