(data stored in ACNUC30630 zone)

EMBL: CP001515.PE402

CP001515.PE402       Location/Qualifiers
FT   CDS             complement(493706..495181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0418"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45800"
FT                   /protein_id="ACS45800.1"
FT                   /translation="MAKKTVNYVCTECGWSGGKWYGRCPECGQWGTIEEFHEAPAATGA
FT                   RTPAPGRTSRTPISVPNVQSAAKPITSISTDTVNRLPTGFGEFDRVLGGGIVPGSVVLI
FT                   AGEPGIGKSTLLLETAGNIAKSVAAAHSRTPDGSDSEPHDAHAGTHDSVLYISGEESQA
FT                   QVRLRASRIGAVEENLLLAATTDLSTVLGLIDSVRPALAIVDSAQTIVSQDVDGISGGS
FT                   TQVREVASALIDSAKSLDVPVLLVGHVTKDGSIAGPRTLEHLVDVVCQFEGESQTALRL
FT                   LRAVKNRFGPTDEVGCFDMSGEGIEEVRDPAGLFLSSQNEPVEGTCVTFTLDGHRSLAV
FT                   EVQSLVTNSVLPTPRRAVNGVDPSRIAMLVAVLYRHGGISLLQNDLYISTIAGGQAKEP
FT                   GCDLAITAAMASAALNKPIAKNVCAIGEISLTGQVRPVPRLEYRLREAQRLGFTKAIVP
FT                   ATQKPLKMEGMTLAPATNLKDALAFLHLAKQRH"
     MAKKTVNYVC TECGWSGGKW YGRCPECGQW GTIEEFHEAP AATGARTPAP GRTSRTPISV        60
     PNVQSAAKPI TSISTDTVNR LPTGFGEFDR VLGGGIVPGS VVLIAGEPGI GKSTLLLETA       120
     GNIAKSVAAA HSRTPDGSDS EPHDAHAGTH DSVLYISGEE SQAQVRLRAS RIGAVEENLL       180
     LAATTDLSTV LGLIDSVRPA LAIVDSAQTI VSQDVDGISG GSTQVREVAS ALIDSAKSLD       240
     VPVLLVGHVT KDGSIAGPRT LEHLVDVVCQ FEGESQTALR LLRAVKNRFG PTDEVGCFDM       300
     SGEGIEEVRD PAGLFLSSQN EPVEGTCVTF TLDGHRSLAV EVQSLVTNSV LPTPRRAVNG       360
     VDPSRIAMLV AVLYRHGGIS LLQNDLYIST IAGGQAKEPG CDLAITAAMA SAALNKPIAK       420
     NVCAIGEISL TGQVRPVPRL EYRLREAQRL GFTKAIVPAT QKPLKMEGMT LAPATNLKDA       480
     LAFLHLAKQR H                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page