(data stored in ACNUC30630 zone)

EMBL: CP001515.PE42

CP001515.PE42        Location/Qualifiers
FT   CDS             45214..45474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0044"
FT                   /product="hypothetical protein"
FT                   /note="COG2336 Growth regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45440"
FT                   /protein_id="ACS45440.1"
FT                   /translation="MTMLTLSKWGNAQAVRLPKAMREQVGMPDDSQIEATVENGAIVLK
FT                   PARSAKRAIRVANLASVFKDRKEPYRACEDDFGAPAGNEGL"
     MTMLTLSKWG NAQAVRLPKA MREQVGMPDD SQIEATVENG AIVLKPARSA KRAIRVANLA        60
     SVFKDRKEPY RACEDDFGAP AGNEGL                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page