(data stored in ACNUC30630 zone)

EMBL: CP001515.PE435

CP001515.PE435       Location/Qualifiers
FT   CDS             541388..541546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45833"
FT                   /protein_id="ACS45833.1"
FT                   /translation="MTKPVERIRLHDGHERGLAQWQSVARIGIFQIQGMLDKICPLRAI
FT                   CEENFII"
     MTKPVERIRL HDGHERGLAQ WQSVARIGIF QIQGMLDKIC PLRAICEENF II                52
//

If you have problems or comments...

PBIL Back to PBIL home page