(data stored in ACNUC30630 zone)

EMBL: CP001515.PE446

CP001515.PE446       Location/Qualifiers
FT   CDS             552271..552696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0465"
FT                   /product="hypothetical protein"
FT                   /note="COG3642 Mn2+-dependent serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45844"
FT                   /protein_id="ACS45844.1"
FT                   /translation="MPFLQPNDKVQAEIRDYRRLCELGIRLPAMLDIDIAKERILKEYI
FT                   DGPTVYNLVLTDQMDDSYVDQVREMAKRLQSHRLNIDYFPTNFVVENGLVYYIDFECTA
FT                   YTRERSFDGWGVTYWSKTPEFLRFVAAHAPHAPAAAQ"
     MPFLQPNDKV QAEIRDYRRL CELGIRLPAM LDIDIAKERI LKEYIDGPTV YNLVLTDQMD        60
     DSYVDQVREM AKRLQSHRLN IDYFPTNFVV ENGLVYYIDF ECTAYTRERS FDGWGVTYWS       120
     KTPEFLRFVA AHAPHAPAAA Q                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page