(data stored in ACNUC30630 zone)

EMBL: CP001515.PE450

CP001515.PE450       Location/Qualifiers
FT   CDS             555508..556920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0469"
FT                   /product="hypothetical protein"
FT                   /note="COG4487 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45848"
FT                   /protein_id="ACS45848.1"
FT                   /translation="MQQVRGQEFDRELESRLKLAEDDKAKAVELARQKANSELQQAKAS
FT                   KDAEISELKAQLAAFEDRQKLAVSEAVGDVEKERDELRHEVERLKSDAESERELAKANL
FT                   EAEKAKAAAEKDVRIQQLQSQLDNVQTSKQLEIAEQVGKVERECDRLRGELSTAKMQQE
FT                   LELKSVREQYEVQLRDREDEIERLRDFKTRLSTKMVGESLERHCQDEFNKVRMGSFPNA
FT                   YFEKDNDARTGSKGDFIFRDYDGPEDDEGRTEFISIMFEMKNENETTATKHRNEDFFKE
FT                   LDKDRREKGCEYAVLVSMLEEDSDLYNQGIVDVSYRYPKMYVIRPQYFIQMITLLRNAA
FT                   RGTLEYRRELAEMRAQNIDITNFEDKLNEFKSGFERNYELASKKFQTVIDEIDKSIDHL
FT                   QKTKKALLGSEDNLRIANKKVQEVTVRRLTYKNPTMQEKFKQARAVRDEEKAIGKVPEV
FT                   GIELAEDTGVER"
     MQQVRGQEFD RELESRLKLA EDDKAKAVEL ARQKANSELQ QAKASKDAEI SELKAQLAAF        60
     EDRQKLAVSE AVGDVEKERD ELRHEVERLK SDAESERELA KANLEAEKAK AAAEKDVRIQ       120
     QLQSQLDNVQ TSKQLEIAEQ VGKVERECDR LRGELSTAKM QQELELKSVR EQYEVQLRDR       180
     EDEIERLRDF KTRLSTKMVG ESLERHCQDE FNKVRMGSFP NAYFEKDNDA RTGSKGDFIF       240
     RDYDGPEDDE GRTEFISIMF EMKNENETTA TKHRNEDFFK ELDKDRREKG CEYAVLVSML       300
     EEDSDLYNQG IVDVSYRYPK MYVIRPQYFI QMITLLRNAA RGTLEYRREL AEMRAQNIDI       360
     TNFEDKLNEF KSGFERNYEL ASKKFQTVID EIDKSIDHLQ KTKKALLGSE DNLRIANKKV       420
     QEVTVRRLTY KNPTMQEKFK QARAVRDEEK AIGKVPEVGI ELAEDTGVER                  470
//

If you have problems or comments...

PBIL Back to PBIL home page