(data stored in ACNUC30630 zone)

EMBL: CP001515.PE463

CP001515.PE463       Location/Qualifiers
FT   CDS             573742..574242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45861"
FT                   /protein_id="ACS45861.1"
FT                   /translation="MTNYQPNYDSNNPYGRGLSEPPMQQEPNQTPFAQPQYGDYGAQGN
FT                   AQQPYAQPQYGQYARGSGQQYGQPDYTQNMSNYAPYGQCNQSQYGNGYSPEPTTWNGLC
FT                   IAGFVCSFLVPIVGLILSIIALTQINRTGEKSRGMAIAGIVISVVIWLFSFIFMASGNS
FT                   IFF"
     MTNYQPNYDS NNPYGRGLSE PPMQQEPNQT PFAQPQYGDY GAQGNAQQPY AQPQYGQYAR        60
     GSGQQYGQPD YTQNMSNYAP YGQCNQSQYG NGYSPEPTTW NGLCIAGFVC SFLVPIVGLI       120
     LSIIALTQIN RTGEKSRGMA IAGIVISVVI WLFSFIFMAS GNSIFF                      166
//

If you have problems or comments...

PBIL Back to PBIL home page