(data stored in ACNUC30630 zone)

EMBL: CP001515.PE479

CP001515.PE479       Location/Qualifiers
FT   CDS             595036..595653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45877"
FT                   /protein_id="ACS45877.1"
FT                   /translation="MKARRTPWWWYVIAMLVGLLAGMGISHLEETRGLGLAGIPYLASA
FT                   VMVVVGFIVLYLAWQVHKYTTTDPKKRAQLKPMDSERCVNTLIVSKALAIAGALLAGWY
FT                   GGQIVMLYDRFEAPFFRHIVIECIIAVIASVIDMVLGIISEGLCQLPPNMGPEHPKVVR
FT                   KRREERLARFTNRASGLPMQAAGHHAGNNGADESDKWEKPCN"
     MKARRTPWWW YVIAMLVGLL AGMGISHLEE TRGLGLAGIP YLASAVMVVV GFIVLYLAWQ        60
     VHKYTTTDPK KRAQLKPMDS ERCVNTLIVS KALAIAGALL AGWYGGQIVM LYDRFEAPFF       120
     RHIVIECIIA VIASVIDMVL GIISEGLCQL PPNMGPEHPK VVRKRREERL ARFTNRASGL       180
     PMQAAGHHAG NNGADESDKW EKPCN                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page