(data stored in ACNUC30630 zone)

EMBL: CP001515.PE485

CP001515.PE485       Location/Qualifiers
FT   CDS             601655..602563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45883"
FT                   /protein_id="ACS45883.1"
FT                   /translation="MDDKTIMYAGNEAGSQTELINPNEIAAMGRRPPTSHRRQPDDDDR
FT                   GFYRRLAVTCVSILAVLAVLIAVIFGIGRHRQSIIAAKRTECERSLVGLDDKVVAYQDL
FT                   VGGDGELASKIADVDVKDMTVVKQLDIEMASESPATVNCDVSSVEEFENRIAQAKASSQ
FT                   WYDEHTASLRSAIQAVNESRHAKQAEDAHASLEEVLRNADNILTSAQGHVTDEAVWDDL
FT                   SKLIGEARNRSGETDMGRIGTLMDDLNARMDAVERSNRENLRQEEQARAEAERKAQEAE
FT                   QKRKEAEAKAKAEEEKNKDKH"
     MDDKTIMYAG NEAGSQTELI NPNEIAAMGR RPPTSHRRQP DDDDRGFYRR LAVTCVSILA        60
     VLAVLIAVIF GIGRHRQSII AAKRTECERS LVGLDDKVVA YQDLVGGDGE LASKIADVDV       120
     KDMTVVKQLD IEMASESPAT VNCDVSSVEE FENRIAQAKA SSQWYDEHTA SLRSAIQAVN       180
     ESRHAKQAED AHASLEEVLR NADNILTSAQ GHVTDEAVWD DLSKLIGEAR NRSGETDMGR       240
     IGTLMDDLNA RMDAVERSNR ENLRQEEQAR AEAERKAQEA EQKRKEAEAK AKAEEEKNKD       300
     KH                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page