(data stored in ACNUC30630 zone)

EMBL: CP001515.PE507

CP001515.PE507       Location/Qualifiers
FT   CDS             629744..630592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0530"
FT                   /product="hypothetical protein"
FT                   /note="COG0561 Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45905"
FT                   /protein_id="ACS45905.1"
FT                   /translation="MAEVEWTEIKEPQDIKLVVADMDATLLDADGQIPAGFWPMLDRLN
FT                   QKGVTFVPASGRQYQTLQQMFSRSVRPMSFIAENGNIVSLDGNVIETHTVSRDLVKQVI
FT                   DICDKAAETGEYNIGLVVCGLNAAYIQRTDEEFIAEVSKYYAKVEPVNNLREVLDYVDE
FT                   KFLKLAIFDFEPAEPMAKDLLAGIEQPYEYVLSGKHWADIMDSRVSKGDGVVVLQKALG
FT                   VGVDETAVFGDYLNDVPMFEHARYSFAVANAHPQVRAAAAYIAPANTEEGVIRVVDRIV
FT                   R"
     MAEVEWTEIK EPQDIKLVVA DMDATLLDAD GQIPAGFWPM LDRLNQKGVT FVPASGRQYQ        60
     TLQQMFSRSV RPMSFIAENG NIVSLDGNVI ETHTVSRDLV KQVIDICDKA AETGEYNIGL       120
     VVCGLNAAYI QRTDEEFIAE VSKYYAKVEP VNNLREVLDY VDEKFLKLAI FDFEPAEPMA       180
     KDLLAGIEQP YEYVLSGKHW ADIMDSRVSK GDGVVVLQKA LGVGVDETAV FGDYLNDVPM       240
     FEHARYSFAV ANAHPQVRAA AAYIAPANTE EGVIRVVDRI VR                          282
//

If you have problems or comments...

PBIL Back to PBIL home page