(data stored in ACNUC30630 zone)

EMBL: CP001515.PE519

CP001515.PE519       Location/Qualifiers
FT   CDS             643205..644338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0542"
FT                   /product="peptide chain release factor 2"
FT                   /note="COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45917"
FT                   /protein_id="ACS45917.1"
FT                   /translation="MAEFDYSQAISDARAKYESIALALDTDRLKSQEAELEQQASAPGL
FT                   WDDSEHAQKVMSQLSACQSQLKHLSSAASRLDDVATLIELGQEENDADTLHEAQTEIES
FT                   IQKDLDQMEIETLMDGEYDSRSAVVTIRSGAGGVDAADFAQMLLRMYLRWAERNGYKAK
FT                   VMDTSYAEEAGIKSATFQIDAPYAYGRMSVEGGTHRLVRISPFDNQGRRQTSFAAVEVV
FT                   PLVEATDHIEVPDSEIRVDTYCASGPGGQGVNTTYSAVRITHLPTGIVVTMQDERSQIQ
FT                   NRAAAMAVLQSRLLVLRHEEEAKKKKELAGDIKASWGDQMRSYVLHPYQMVKDLRTGCE
FT                   TSQTQAVFDGDIDEFIQAGIRWRHEQRLEAAAEEANE"
     MAEFDYSQAI SDARAKYESI ALALDTDRLK SQEAELEQQA SAPGLWDDSE HAQKVMSQLS        60
     ACQSQLKHLS SAASRLDDVA TLIELGQEEN DADTLHEAQT EIESIQKDLD QMEIETLMDG       120
     EYDSRSAVVT IRSGAGGVDA ADFAQMLLRM YLRWAERNGY KAKVMDTSYA EEAGIKSATF       180
     QIDAPYAYGR MSVEGGTHRL VRISPFDNQG RRQTSFAAVE VVPLVEATDH IEVPDSEIRV       240
     DTYCASGPGG QGVNTTYSAV RITHLPTGIV VTMQDERSQI QNRAAAMAVL QSRLLVLRHE       300
     EEAKKKKELA GDIKASWGDQ MRSYVLHPYQ MVKDLRTGCE TSQTQAVFDG DIDEFIQAGI       360
     RWRHEQRLEA AAEEANE                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page