(data stored in ACNUC30630 zone)

EMBL: CP001515.PE530

CP001515.PE530       Location/Qualifiers
FT   CDS             complement(656514..657200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0553"
FT                   /product="response regulator of two-component system"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45928"
FT                   /protein_id="ACS45928.1"
FT                   /translation="MYTNMNPDSEPWNIALVDNDALVRSYLETYLGGLPEFNICWSMQS
FT                   GRDAVEAYHHSIACTNCVPDLIVTDLSMHGMSGFELCATIRFENDHTPILGCSSYMIEP
FT                   YERDAVNNGMQGLLLKNELAQLADGMRTLLSGQPLLKSNGMPYETPQQAHERLLMQGKP
FT                   AIMSMSPNEQAVMELCSEGLSTRTIAEETGDSESTVKTYISRAMRKLRAKSRAEAVASW
FT                   SRKTKL"
     MYTNMNPDSE PWNIALVDND ALVRSYLETY LGGLPEFNIC WSMQSGRDAV EAYHHSIACT        60
     NCVPDLIVTD LSMHGMSGFE LCATIRFEND HTPILGCSSY MIEPYERDAV NNGMQGLLLK       120
     NELAQLADGM RTLLSGQPLL KSNGMPYETP QQAHERLLMQ GKPAIMSMSP NEQAVMELCS       180
     EGLSTRTIAE ETGDSESTVK TYISRAMRKL RAKSRAEAVA SWSRKTKL                    228
//

If you have problems or comments...

PBIL Back to PBIL home page