(data stored in ACNUC30630 zone)

EMBL: CP001515.PE552

CP001515.PE552       Location/Qualifiers
FT   CDS             680207..680563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0575"
FT                   /product="hypothetical protein"
FT                   /note="COG3177 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45950"
FT                   /protein_id="ACS45950.1"
FT                   /translation="MDDLFAWWDNNDISDSVIDDIIRFHYRFLALRPFAQGTGRMSRLL
FT                   LLLQLIARGVLHEPILTMSIWLEGNIAEYRTCLDEAILRGNEQPLLMFFHDGFSDCAGA
FT                   ACNSVVSHSDSYRM"
     MDDLFAWWDN NDISDSVIDD IIRFHYRFLA LRPFAQGTGR MSRLLLLLQL IARGVLHEPI        60
     LTMSIWLEGN IAEYRTCLDE AILRGNEQPL LMFFHDGFSD CAGAACNSVV SHSDSYRM         118
//

If you have problems or comments...

PBIL Back to PBIL home page