(data stored in ACNUC30630 zone)

EMBL: CP001515.PE565

CP001515.PE565       Location/Qualifiers
FT   CDS             695656..696153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0589"
FT                   /product="phosphoribosylaminoimidazole carboxylasecatalytic
FT                   subunit"
FT                   /note="COG0041 Phosphoribosylcarboxyaminoimidazole (NCAIR
FT                   mutase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45963"
FT                   /protein_id="ACS45963.1"
FT                   /translation="MTANKPQVAVIMGSASDWETMRYACEMLDRFEVPYMKQVVSAHRT
FT                   PELMGEFAHNARANGLKIIIAGAGGAAHLPGMVAAQTTLPVIGVPVRSHALSGWDSLLS
FT                   IVQMPGGIPVATTAVGNSGATNAGLLAVSMLSMNDERLADALQAYRDELKEKVEQSNAE
FT                   LI"
     MTANKPQVAV IMGSASDWET MRYACEMLDR FEVPYMKQVV SAHRTPELMG EFAHNARANG        60
     LKIIIAGAGG AAHLPGMVAA QTTLPVIGVP VRSHALSGWD SLLSIVQMPG GIPVATTAVG       120
     NSGATNAGLL AVSMLSMNDE RLADALQAYR DELKEKVEQS NAELI                       165
//

If you have problems or comments...

PBIL Back to PBIL home page