(data stored in ACNUC30630 zone)

EMBL: CP001515.PE567

CP001515.PE567       Location/Qualifiers
FT   CDS             697329..697730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0591"
FT                   /product="metal uptake regulator ferric uptake regulator
FT                   protein"
FT                   /note="COG0735 Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45965"
FT                   /protein_id="ACS45965.1"
FT                   /translation="MGERNTRQKDVIREALQGADDFISAQQLHARLEDAGEHIALATVY
FT                   RQLGTMADAKQVDTVRLNGQQLFRLCNAGGHHHHLMCVSCGRTVEIDPPSEAWLQSVAQ
FT                   QHDFTIESHTLEVFGLCADCRAARGDCAA"
     MGERNTRQKD VIREALQGAD DFISAQQLHA RLEDAGEHIA LATVYRQLGT MADAKQVDTV        60
     RLNGQQLFRL CNAGGHHHHL MCVSCGRTVE IDPPSEAWLQ SVAQQHDFTI ESHTLEVFGL       120
     CADCRAARGD CAA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page