(data stored in ACNUC30630 zone)

EMBL: CP001515.PE574

CP001515.PE574       Location/Qualifiers
FT   CDS             707867..708280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45972"
FT                   /protein_id="ACS45972.1"
FT                   /translation="MTLENLHRYDDIIDLPHHRSTKHRHMSNLERAVQFMPFAALKGHD
FT                   ERVREVSSTPCTRIALADDERETLNDRLVEVIGQLESHPYASITYFQPEGGRDAGEYMT
FT                   AEGAVRRFDQMRRVIVMEDGTRIALVNIVDIRC"
     MTLENLHRYD DIIDLPHHRS TKHRHMSNLE RAVQFMPFAA LKGHDERVRE VSSTPCTRIA        60
     LADDERETLN DRLVEVIGQL ESHPYASITY FQPEGGRDAG EYMTAEGAVR RFDQMRRVIV       120
     MEDGTRIALV NIVDIRC                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page