(data stored in ACNUC30630 zone)

EMBL: CP001515.PE581

CP001515.PE581       Location/Qualifiers
FT   CDS             712413..713951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45979"
FT                   /protein_id="ACS45979.1"
FT                   /translation="MADQIYMASVESTYAAMEQMLQFSAVLDVVSRNADERTVTFSVPG
FT                   INGLFTAKVAEGDAAGSSKVTVTAPIDGGDKAQESVAKFYKDLGDQLMVQGAVQSAPQQ
FT                   TPVFDAQNQPTQTFQAPVPAAAGNGGNPAQGTKNKFVAMLTDTNTGKTSVMAIAAAVVS
FT                   AVFLIFGFVSLGMHPPVVVGIIFAVVAAVLCALAYTKTQPGREHGRMLTVVAAGVTVVA
FT                   LTLSLVGAAGGSKSHGSMKEASSSSSPSSSDDDPFCKPISWPSAGVGAKAPKPNSLKGY
FT                   VWTDDADYVNIKLCDVDDAAYTDYLNKVKDSGFVEDYKSTSGDYSAKDSEGNFIDLTFF
FT                   SSLTELDVTVKSAERYQNDLSEKEKQEEEAEAKKKAEEEAKNKAEAEKAAAEEAKKAEE
FT                   EQKRLAEEEKKLKEEAAEKQNTQSNAANGVTPDVKEALDGYETFMNKYCDFMEKYAKEG
FT                   RPAGMLTDYLEMLNEYTDYTQKLSNLDQSAWTDADMNYFIEVTNRVNQRLASVS"
     MADQIYMASV ESTYAAMEQM LQFSAVLDVV SRNADERTVT FSVPGINGLF TAKVAEGDAA        60
     GSSKVTVTAP IDGGDKAQES VAKFYKDLGD QLMVQGAVQS APQQTPVFDA QNQPTQTFQA       120
     PVPAAAGNGG NPAQGTKNKF VAMLTDTNTG KTSVMAIAAA VVSAVFLIFG FVSLGMHPPV       180
     VVGIIFAVVA AVLCALAYTK TQPGREHGRM LTVVAAGVTV VALTLSLVGA AGGSKSHGSM       240
     KEASSSSSPS SSDDDPFCKP ISWPSAGVGA KAPKPNSLKG YVWTDDADYV NIKLCDVDDA       300
     AYTDYLNKVK DSGFVEDYKS TSGDYSAKDS EGNFIDLTFF SSLTELDVTV KSAERYQNDL       360
     SEKEKQEEEA EAKKKAEEEA KNKAEAEKAA AEEAKKAEEE QKRLAEEEKK LKEEAAEKQN       420
     TQSNAANGVT PDVKEALDGY ETFMNKYCDF MEKYAKEGRP AGMLTDYLEM LNEYTDYTQK       480
     LSNLDQSAWT DADMNYFIEV TNRVNQRLAS VS                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page