(data stored in ACNUC30630 zone)

EMBL: CP001515.PE582

CP001515.PE582       Location/Qualifiers
FT   CDS             713977..714705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45980"
FT                   /protein_id="ACS45980.1"
FT                   /translation="MSASTPAVNRVPVARQTFRAPVAEVYAALVQTLHFSAGFDVVAND
FT                   DVTHSVRFRLPNDNGEYEARVIADGMHSAVIIEAPAGTAGGSAAYSRLYRELAEQIVAQ
FT                   STVVPHDVIAKRRFRQAIVADNDGPRSKWAIGAVVFACGALLGALAMFSDLRPDWQVCV
FT                   TLIVSLFVVCGIAFAVTGRNGKVSGRNLVLIAFAISCLASVLLLCATIVVQIRYSTTLA
FT                   ISETMAQTASALPLEMPKQQ"
     MSASTPAVNR VPVARQTFRA PVAEVYAALV QTLHFSAGFD VVANDDVTHS VRFRLPNDNG        60
     EYEARVIADG MHSAVIIEAP AGTAGGSAAY SRLYRELAEQ IVAQSTVVPH DVIAKRRFRQ       120
     AIVADNDGPR SKWAIGAVVF ACGALLGALA MFSDLRPDWQ VCVTLIVSLF VVCGIAFAVT       180
     GRNGKVSGRN LVLIAFAISC LASVLLLCAT IVVQIRYSTT LAISETMAQT ASALPLEMPK       240
     QQ                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page