(data stored in ACNUC30630 zone)

EMBL: CP001515.PE591

CP001515.PE591       Location/Qualifiers
FT   CDS             726586..726720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45989"
FT                   /protein_id="ACS45989.1"
FT                   /translation="MDARPVGDSKPRHAAESEKCVPYVMAGEWWNIPFAPLLSMVMGS"
     MDARPVGDSK PRHAAESEKC VPYVMAGEWW NIPFAPLLSM VMGS                         44
//

If you have problems or comments...

PBIL Back to PBIL home page