(data stored in ACNUC30630 zone)

EMBL: CP001515.PE596

CP001515.PE596       Location/Qualifiers
FT   CDS             complement(731665..732339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45994"
FT                   /protein_id="ACS45994.1"
FT                   /translation="MVRSRTAQLIFQSFYCAFGIVGILGSFGMYDGSFDNVFYVYFTNL
FT                   SNYLCIAVMFFELVQTANRKQDGYVKLSPALKFISVTAILLTFFVFNLLLANAPDRNPL
FT                   ENFKVTSITFHVVLPLMFVADWLLFYEHRKVKWTYPLYSTVFPLVYLAFVYMRAWLVNF
FT                   DTAVPKLYPYFFIDANQQGIAGVVRWCLILLAAFIVLGYILMAVDRMMPAAKESTPIDS
FT                   AD"
     MVRSRTAQLI FQSFYCAFGI VGILGSFGMY DGSFDNVFYV YFTNLSNYLC IAVMFFELVQ        60
     TANRKQDGYV KLSPALKFIS VTAILLTFFV FNLLLANAPD RNPLENFKVT SITFHVVLPL       120
     MFVADWLLFY EHRKVKWTYP LYSTVFPLVY LAFVYMRAWL VNFDTAVPKL YPYFFIDANQ       180
     QGIAGVVRWC LILLAAFIVL GYILMAVDRM MPAAKESTPI DSAD                        224
//

If you have problems or comments...

PBIL Back to PBIL home page