(data stored in ACNUC30630 zone)

EMBL: CP001515.PE600

CP001515.PE600       Location/Qualifiers
FT   CDS             734522..735757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0625"
FT                   /product="carbamoyl phosphate synthase small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="COG0505 Carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45998"
FT                   /protein_id="ACS45998.1"
FT                   /translation="MVTQFDPANEYTAQDAVLVLEDGQVYVGEPFGATGSTCAEIVFNT
FT                   AMTGYQETLTDPSYDRQIVVQTFPHIGDTGVNDDDLESSRIWVAGYVVRDPSMVVSNWR
FT                   AAGSLDDDLMANHIVGISHIDTRKLVRHLRSAGVMRAGIFSGAALVGSNGEPREISDML
FT                   EEVQRTPQMKGMSLYDEVSTPEAYVVEPAGDFEGKEPLFTVAAVDLGIKAMTPHRMAER
FT                   GCRVVVLPSTVTFDEIQELNPDGVFFSNGPGDPEQAGQMVSLLRQVLDAGYPFFGICFG
FT                   NQLLGRALGFGTYKLKFGHRGINQPVKDVTTGKVEVTAHNHGFAVDAPIGETVDAPFEN
FT                   GRYGKVFVSHVDLNDNVVEGLQCVDIPAFSVQYHPEAAAGPHDAAYLFDRFVSMMDNSR
FT                   DSKASKEENANA"
     MVTQFDPANE YTAQDAVLVL EDGQVYVGEP FGATGSTCAE IVFNTAMTGY QETLTDPSYD        60
     RQIVVQTFPH IGDTGVNDDD LESSRIWVAG YVVRDPSMVV SNWRAAGSLD DDLMANHIVG       120
     ISHIDTRKLV RHLRSAGVMR AGIFSGAALV GSNGEPREIS DMLEEVQRTP QMKGMSLYDE       180
     VSTPEAYVVE PAGDFEGKEP LFTVAAVDLG IKAMTPHRMA ERGCRVVVLP STVTFDEIQE       240
     LNPDGVFFSN GPGDPEQAGQ MVSLLRQVLD AGYPFFGICF GNQLLGRALG FGTYKLKFGH       300
     RGINQPVKDV TTGKVEVTAH NHGFAVDAPI GETVDAPFEN GRYGKVFVSH VDLNDNVVEG       360
     LQCVDIPAFS VQYHPEAAAG PHDAAYLFDR FVSMMDNSRD SKASKEENAN A                411
//

If you have problems or comments...

PBIL Back to PBIL home page