(data stored in ACNUC30630 zone)

EMBL: CP001515.PE613

CP001515.PE613       Location/Qualifiers
FT   CDS             752768..754372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0638"
FT                   /product="proteasome-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46011"
FT                   /protein_id="ACS46011.1"
FT                   /translation="MSVRRVMGTETEYAVSVRQDPHANPVQSSFDVIAHAGDEETRHIR
FT                   WDYRQEDPVHDMRGMTMPRAAARPDMLTDEPQRNITNTFAANGGRMYVDHAHPEYSAPE
FT                   TRDPFEAVAYDFAGDLLMRQAAQSASTERHQFEVFRNNADGKGAAWGSHENYLLRRDVD
FT                   FDVVTALMLVHFATRQIYTGSGRVGLGERGERAGYQLSQRADYFHMKVGLQTTFDRPIV
FT                   NTRDESHAPDEMRRLHVIVGDANRLEVPDVLKLGTTSMLLWVAEQASALDYDLTDELRS
FT                   LSLLDSVAAMHTVSHDLTFDEPLALANGGSSTAWQLQVSLRGLVYEVASMVYGTDSLGE
FT                   PVWPDSQTRSVMAMWQQALIDVAEVRHADDDTRMTMTAQASRLEWLLKWQLLERMRRRI
FT                   AGCGASSASGWDNPQVRALELRWASLAPENEAVFAKVRSRAERVVTDERIAAAATDAPA
FT                   DTRAWFRAAILHRFPTELRAISWTRITTVADGAGDSWTLDMRDPTRFTKDDTERQVEEA
FT                   SSAAQLIRSLGGICEHS"
     MSVRRVMGTE TEYAVSVRQD PHANPVQSSF DVIAHAGDEE TRHIRWDYRQ EDPVHDMRGM        60
     TMPRAAARPD MLTDEPQRNI TNTFAANGGR MYVDHAHPEY SAPETRDPFE AVAYDFAGDL       120
     LMRQAAQSAS TERHQFEVFR NNADGKGAAW GSHENYLLRR DVDFDVVTAL MLVHFATRQI       180
     YTGSGRVGLG ERGERAGYQL SQRADYFHMK VGLQTTFDRP IVNTRDESHA PDEMRRLHVI       240
     VGDANRLEVP DVLKLGTTSM LLWVAEQASA LDYDLTDELR SLSLLDSVAA MHTVSHDLTF       300
     DEPLALANGG SSTAWQLQVS LRGLVYEVAS MVYGTDSLGE PVWPDSQTRS VMAMWQQALI       360
     DVAEVRHADD DTRMTMTAQA SRLEWLLKWQ LLERMRRRIA GCGASSASGW DNPQVRALEL       420
     RWASLAPENE AVFAKVRSRA ERVVTDERIA AAATDAPADT RAWFRAAILH RFPTELRAIS       480
     WTRITTVADG AGDSWTLDMR DPTRFTKDDT ERQVEEASSA AQLIRSLGGI CEHS             534
//

If you have problems or comments...

PBIL Back to PBIL home page