(data stored in ACNUC30630 zone)

EMBL: CP001515.PE626

CP001515.PE626       Location/Qualifiers
FT   CDS             complement(766940..767905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0651"
FT                   /product="hypothetical protein"
FT                   /note="COG1721 Uncharacterized conserved protein (some
FT                   members contain a von Willebrand factor type A
FT                   (vWAdomain))"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46024"
FT                   /protein_id="ACS46024.1"
FT                   /translation="MIGTNHDANRSDPIRRKIEMLGTSLSLPTVRRAMGILEGEHASAR
FT                   RGGNDDLLDIRAYEVGDEARQIDWKISARNGRAMIAQRERLSSTRVYLLLDAGVEMTEV
FT                   CPSDEMAYRIAANALCMFAALSLRRSDEVSLVFGDSSNITRVPFHGGLAQFEHTLDKAL
FT                   DRGWRFPRNIDALLDYAAHIRDREALIVLATDDHALDDTHMRAIRRITQTHPLVLINVG
FT                   TINPFSSDPIPSRPHASLVDGATDRRIPAFLRNTKAAQELDTHRAYLLQALDRELLRCG
FT                   SRMIHASSSEGMFHAFVRLLSLSHASVFTPVTIPEGTANA"
     MIGTNHDANR SDPIRRKIEM LGTSLSLPTV RRAMGILEGE HASARRGGND DLLDIRAYEV        60
     GDEARQIDWK ISARNGRAMI AQRERLSSTR VYLLLDAGVE MTEVCPSDEM AYRIAANALC       120
     MFAALSLRRS DEVSLVFGDS SNITRVPFHG GLAQFEHTLD KALDRGWRFP RNIDALLDYA       180
     AHIRDREALI VLATDDHALD DTHMRAIRRI TQTHPLVLIN VGTINPFSSD PIPSRPHASL       240
     VDGATDRRIP AFLRNTKAAQ ELDTHRAYLL QALDRELLRC GSRMIHASSS EGMFHAFVRL       300
     LSLSHASVFT PVTIPEGTAN A                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page