(data stored in ACNUC30630 zone)

EMBL: CP001515.PE629

CP001515.PE629       Location/Qualifiers
FT   CDS             769989..770672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46027"
FT                   /protein_id="ACS46027.1"
FT                   /translation="MARNDDHKYESYPKDSFDNPPTGPVGVHNGRRSWPVRLTPYAIVI
FT                   VVAAAVGVLFWSAFSGEAANMFKHGDRETVVASSSTTTTTSPSSTSASESESPSQSASA
FT                   SASESPSQSPSQSPSQSSESPSQSPSEEQTPEQKVNLDASISVINGTATNGYAAQEAQR
FT                   LQGAGFTNVAPSNPNGMQLPSQSVVWYQNDADLATAQKVAETLGVSTVQKAEGIAVPVA
FT                   VVLMN"
     MARNDDHKYE SYPKDSFDNP PTGPVGVHNG RRSWPVRLTP YAIVIVVAAA VGVLFWSAFS        60
     GEAANMFKHG DRETVVASSS TTTTTSPSST SASESESPSQ SASASASESP SQSPSQSPSQ       120
     SSESPSQSPS EEQTPEQKVN LDASISVING TATNGYAAQE AQRLQGAGFT NVAPSNPNGM       180
     QLPSQSVVWY QNDADLATAQ KVAETLGVST VQKAEGIAVP VAVVLMN                     227
//

If you have problems or comments...

PBIL Back to PBIL home page