(data stored in ACNUC30630 zone)

EMBL: CP001515.PE635

CP001515.PE635       Location/Qualifiers
FT   CDS             775403..777148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0660"
FT                   /product="sensor protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46033"
FT                   /protein_id="ACS46033.1"
FT                   /translation="MKDTPLAQVAAADARKGQSSQNQPHTHRSRRLAALNECIPLSVRL
FT                   MSIIVGMLSIGTIVITFSIRWLVSSYPMERVDQQLLEQADLVFPQMLNTDVNTQNGFTS
FT                   YYVKVYNTNTGSSAVMLQPVLKDGVISSPKLPDNGSLDGHELGVPFTTPAVVNTKNVVG
FT                   VPDHATMQFAECPWRVVALKGLTKSGKGEFQDLGIVYIGLSLGDQIDVISTLTRFCIMV
FT                   SIAVVLLGGSLGALVVQRTLSPLKRIEKTAAKIAAGDLSQRVPESGESTEIGSLARSLN
FT                   SMLTQIERSFHEQEAVTQKMRQFVSDASHELRTPLAAIHGYAELYKMQRDAPGTLERAD
FT                   DAISHIESSSSRMTVLVEDLLSLARLDEGRGVSMNQRVDFTSVMQDSVDDLHALDPDRE
FT                   ITTMQLDIDLSAPRKPKLSETPGPLPKIALTGDATRLHQVITNIVGNIHRYTPSDSPVD
FT                   IGLGVIESSRTPEDLAAMPQDGDMLETLLQGARKSKSSKLLSMYAVAVLRDHGPGVPEK
FT                   SLHNIFERFYTADPSRDRQKGGTGLGLAIALSIVNAHGGRIYASPTEGSGLTFTIILPM
FT                   ESGTD"
     MKDTPLAQVA AADARKGQSS QNQPHTHRSR RLAALNECIP LSVRLMSIIV GMLSIGTIVI        60
     TFSIRWLVSS YPMERVDQQL LEQADLVFPQ MLNTDVNTQN GFTSYYVKVY NTNTGSSAVM       120
     LQPVLKDGVI SSPKLPDNGS LDGHELGVPF TTPAVVNTKN VVGVPDHATM QFAECPWRVV       180
     ALKGLTKSGK GEFQDLGIVY IGLSLGDQID VISTLTRFCI MVSIAVVLLG GSLGALVVQR       240
     TLSPLKRIEK TAAKIAAGDL SQRVPESGES TEIGSLARSL NSMLTQIERS FHEQEAVTQK       300
     MRQFVSDASH ELRTPLAAIH GYAELYKMQR DAPGTLERAD DAISHIESSS SRMTVLVEDL       360
     LSLARLDEGR GVSMNQRVDF TSVMQDSVDD LHALDPDREI TTMQLDIDLS APRKPKLSET       420
     PGPLPKIALT GDATRLHQVI TNIVGNIHRY TPSDSPVDIG LGVIESSRTP EDLAAMPQDG       480
     DMLETLLQGA RKSKSSKLLS MYAVAVLRDH GPGVPEKSLH NIFERFYTAD PSRDRQKGGT       540
     GLGLAIALSI VNAHGGRIYA SPTEGSGLTF TIILPMESGT D                           581
//

If you have problems or comments...

PBIL Back to PBIL home page