(data stored in ACNUC30630 zone)

EMBL: CP001515.PE637

CP001515.PE637       Location/Qualifiers
FT   CDS             777720..778850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46035"
FT                   /protein_id="ACS46035.1"
FT                   /translation="MATSEFDPIALARAEAIDTAHEPEDVGEFVTSEAHDDGVTDFRFE
FT                   ALMKGYEGWQWSVTLYHDVELDHWTIDESSLIPTDKALLPPKWVPWKDRLLPSDLSVTD
FT                   SIGTPEDDERLDDGIGIDEAVSRTEELNAEQQAVETVQAQEGGSPDEQADALTAVEDVV
FT                   EAVEELDLSRRHVLSELGQTQTAQRWYEGPHGPKSLSTKTADGNLCSTCGFFIPLAGSL
FT                   KTMFGVCANRWSPDDGKVVSVDHGCGEHSEIRPPEPSRMWVQTKPAYDDLHIDVVAQHG
FT                   RDERKDEELLESLDEVDAESLAGLKQKALDMDDDMPDTSSFGIGSVSPQDFSGEEPEAD
FT                   STVERSAAKEVCEDEDAEQIDSMCTSETVIAEEAGE"
     MATSEFDPIA LARAEAIDTA HEPEDVGEFV TSEAHDDGVT DFRFEALMKG YEGWQWSVTL        60
     YHDVELDHWT IDESSLIPTD KALLPPKWVP WKDRLLPSDL SVTDSIGTPE DDERLDDGIG       120
     IDEAVSRTEE LNAEQQAVET VQAQEGGSPD EQADALTAVE DVVEAVEELD LSRRHVLSEL       180
     GQTQTAQRWY EGPHGPKSLS TKTADGNLCS TCGFFIPLAG SLKTMFGVCA NRWSPDDGKV       240
     VSVDHGCGEH SEIRPPEPSR MWVQTKPAYD DLHIDVVAQH GRDERKDEEL LESLDEVDAE       300
     SLAGLKQKAL DMDDDMPDTS SFGIGSVSPQ DFSGEEPEAD STVERSAAKE VCEDEDAEQI       360
     DSMCTSETVI AEEAGE                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page