(data stored in ACNUC30630 zone)

EMBL: CP001515.PE651

CP001515.PE651       Location/Qualifiers
FT   CDS             797610..799124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0676"
FT                   /product="recombination factor protein RarA"
FT                   /note="COG2256 ATPase related to the helicase subunit ofthe
FT                   Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46049"
FT                   /protein_id="ACS46049.1"
FT                   /translation="MTNDLFAASDPSEEVVRPLAVRMRPTTLDEVVGQRHVLAPGSPLR
FT                   RLADSASTGSLTAPSSVILFGPPGVGKTTLAHIVAKQSGRQYEELSAVTSGVKDLREVL
FT                   RRAHERLVSQGKETVLFIDEVHRFSKSQQDALLPSVENRDVTFIAATTENPSFSVIKPL
FT                   LSRSVVVKLESLEPEELRTVIERAVSNPRGLGGKVRVQGDAVDGIIRLAGGDARKSLTI
FT                   LEAAAGAVDESGSNVPAEITTDVVSTVMDVAAVRYDRNGDDHYDVISAFIKSMRGSDVD
FT                   ATLHYLARMIRAGEDPRFIARRIMIAAAEEVGMAAPQILQITVAAAQAVQMIGMPEARI
FT                   ILSEAAIAVATAPKSNASYTAINQALADVDAGLIGQVPLHIRNAPTTLMKSWGNHEGYH
FT                   YAHDYPNAVVEQQYMPDVLVGREYYHPNSRGYEREIGPRLDRIRAIIHGEPAPPAPTQT
FT                   ERKPTEPVDPAHTEHPGETQRSQMKGKNDDATDTGRKEEDREPGGE"
     MTNDLFAASD PSEEVVRPLA VRMRPTTLDE VVGQRHVLAP GSPLRRLADS ASTGSLTAPS        60
     SVILFGPPGV GKTTLAHIVA KQSGRQYEEL SAVTSGVKDL REVLRRAHER LVSQGKETVL       120
     FIDEVHRFSK SQQDALLPSV ENRDVTFIAA TTENPSFSVI KPLLSRSVVV KLESLEPEEL       180
     RTVIERAVSN PRGLGGKVRV QGDAVDGIIR LAGGDARKSL TILEAAAGAV DESGSNVPAE       240
     ITTDVVSTVM DVAAVRYDRN GDDHYDVISA FIKSMRGSDV DATLHYLARM IRAGEDPRFI       300
     ARRIMIAAAE EVGMAAPQIL QITVAAAQAV QMIGMPEARI ILSEAAIAVA TAPKSNASYT       360
     AINQALADVD AGLIGQVPLH IRNAPTTLMK SWGNHEGYHY AHDYPNAVVE QQYMPDVLVG       420
     REYYHPNSRG YEREIGPRLD RIRAIIHGEP APPAPTQTER KPTEPVDPAH TEHPGETQRS       480
     QMKGKNDDAT DTGRKEEDRE PGGE                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page