(data stored in ACNUC30630 zone)

EMBL: CP001515.PE657

CP001515.PE657       Location/Qualifiers
FT   CDS             805979..806635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0682"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46055"
FT                   /protein_id="ACS46055.1"
FT                   /translation="MLCETWHKQDPQMDEDLQMKLAQIDLEYCLARTTTAEVAVRDGEV
FT                   VGAVLGRIDAQETRKGINQHHRSVMKIMGPLFFNKSAHQALKNMLNAEKADRQMIKQAK
FT                   KDGHAYDGEIVLFIVREDMRGQGIGQHLFDWMLNEFKVNNVEHYFLYTDTDCDYGFYED
FT                   RGMVRRMEMPMEPHTPKEDTEAHQEADYLDNHLHALMFDNETSPANEGVNPLGRD"
     MLCETWHKQD PQMDEDLQMK LAQIDLEYCL ARTTTAEVAV RDGEVVGAVL GRIDAQETRK        60
     GINQHHRSVM KIMGPLFFNK SAHQALKNML NAEKADRQMI KQAKKDGHAY DGEIVLFIVR       120
     EDMRGQGIGQ HLFDWMLNEF KVNNVEHYFL YTDTDCDYGF YEDRGMVRRM EMPMEPHTPK       180
     EDTEAHQEAD YLDNHLHALM FDNETSPANE GVNPLGRD                               218
//

If you have problems or comments...

PBIL Back to PBIL home page