(data stored in ACNUC30630 zone)

EMBL: CP001515.PE659

CP001515.PE659       Location/Qualifiers
FT   CDS             complement(807099..807509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0684"
FT                   /product="hypothetical protein"
FT                   /note="COG3304 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46057"
FT                   /protein_id="ACS46057.1"
FT                   /translation="MDIVRLAAYPWPAYTVGMRFIGNLIWLVLGGLEIAFAWFVVGLVL
FT                   CVTIVGIPLGVQSFKMAQLTLTPFGQHVVYGGSVGSLLLNIVWVVLVGWWMALGYLIAG
FT                   VLNCITVIGVPFGIQSFKMCKLALWPFGTTID"
     MDIVRLAAYP WPAYTVGMRF IGNLIWLVLG GLEIAFAWFV VGLVLCVTIV GIPLGVQSFK        60
     MAQLTLTPFG QHVVYGGSVG SLLLNIVWVV LVGWWMALGY LIAGVLNCIT VIGVPFGIQS       120
     FKMCKLALWP FGTTID                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page