(data stored in ACNUC30630 zone)

EMBL: CP001515.PE664

CP001515.PE664       Location/Qualifiers
FT   CDS             complement(812594..813085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0689"
FT                   /product="Hypothetical membrane protein"
FT                   /note="COG3601 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46062"
FT                   /protein_id="ACS46062.1"
FT                   /translation="MYALFVALAMAVSFIEIPLMPAAPWLKYDPSGIVCILAGFAFGPS
FT                   GAVIVSVLGFVPHLFVNPLGAVMAILVALGYSLPVAFIYRRRSTRTGALTGILLGAAVA
FT                   LAAAIVGNLFITPLYAHMSMQQVASMIVPILLPFNLLKFAINGVVSFLCYRPVCKLIAR
FT                   "
     MYALFVALAM AVSFIEIPLM PAAPWLKYDP SGIVCILAGF AFGPSGAVIV SVLGFVPHLF        60
     VNPLGAVMAI LVALGYSLPV AFIYRRRSTR TGALTGILLG AAVALAAAIV GNLFITPLYA       120
     HMSMQQVASM IVPILLPFNL LKFAINGVVS FLCYRPVCKL IAR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page