(data stored in ACNUC30630 zone)

EMBL: CP001515.PE670

CP001515.PE670       Location/Qualifiers
FT   CDS             822269..824860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0695"
FT                   /product="LigA"
FT                   /note="COG0272 NAD-dependent DNA ligase (contains BRCT
FT                   domain type II)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46068"
FT                   /protein_id="ACS46068.1"
FT                   /translation="MEDALIADEQLDRYPIGSDPWIDSLRDIDSDAMELDDLDVSKLNV
FT                   EQAVRLWSRLSAWVEGDQVAYYVKDAPLSSDAAYDARMNCLKRLESEFPQLDTPQSPTH
FT                   RVGGTFSNDFTAVRHPSQMMSLDDVFSFEELRAWYDGVRKDLEWPEDKLLPMTCEVKID
FT                   GLALNLIYRNGVLTQGLTRGDGVTGEDITMNVRTIHSIPTNLDGPEGDIPDMVEIRGEV
FT                   FMRWDDFHKLNEANEDAGRPPFANPRNAAAGSLRQKDPRITAQRHLSFYAHGIGELVWG
FT                   SGKPVDVADEVRNQSDAYTMYRKWGVPISPHNREVTDFDQILDMIEYYGEHRGDIEHAL
FT                   DGIVVKVDDLALQRRLGSTSRAPRWAIAYKYPPEEVNTKLLNIVVQVGRTGRVTPVAIL
FT                   NPVYVAGSTVSRTTLHNAYEVKRKGILIGDTVVVRKAGDVIPELVGPVIAKREGHEQDL
FT                   REFVMPTRCPSCDTVLRYEKEGDKDLRCPNSESCPAQLAERVINLAARKAFDIEHLGDQ
FT                   SAVALTNPEDNRPDSVEAYAPGVREIVVEPGEEPAPYLAPSGLELPPIQEPVLTSEANL
FT                   FDLEASDLRDVYVWREAQIIEVRRHVDSHGKERKVRHRLGGSGLWHREPAFWSGVKDAP
FT                   LKKDANRKTVKDSEGNPEYEVKPDAVIVGHGRNGRPRIEEPTENTRKMLDEIEKAKHTD
FT                   LSRVLVALSIRHVGPPTAFTLAKHFKTLDALADASAEELEQIDGIGAEIADSIATFFEE
FT                   ARMPGNWRGRVLEAWKAAGVGMSTHDEGLPQTLEGKSVVVTGTLEHFSRESAKEAIERR
FT                   GGKASGSVSRKTDWVVVGANPGSKATKAEELGIPIIDEQQFDTLLATGDVQ"
     MEDALIADEQ LDRYPIGSDP WIDSLRDIDS DAMELDDLDV SKLNVEQAVR LWSRLSAWVE        60
     GDQVAYYVKD APLSSDAAYD ARMNCLKRLE SEFPQLDTPQ SPTHRVGGTF SNDFTAVRHP       120
     SQMMSLDDVF SFEELRAWYD GVRKDLEWPE DKLLPMTCEV KIDGLALNLI YRNGVLTQGL       180
     TRGDGVTGED ITMNVRTIHS IPTNLDGPEG DIPDMVEIRG EVFMRWDDFH KLNEANEDAG       240
     RPPFANPRNA AAGSLRQKDP RITAQRHLSF YAHGIGELVW GSGKPVDVAD EVRNQSDAYT       300
     MYRKWGVPIS PHNREVTDFD QILDMIEYYG EHRGDIEHAL DGIVVKVDDL ALQRRLGSTS       360
     RAPRWAIAYK YPPEEVNTKL LNIVVQVGRT GRVTPVAILN PVYVAGSTVS RTTLHNAYEV       420
     KRKGILIGDT VVVRKAGDVI PELVGPVIAK REGHEQDLRE FVMPTRCPSC DTVLRYEKEG       480
     DKDLRCPNSE SCPAQLAERV INLAARKAFD IEHLGDQSAV ALTNPEDNRP DSVEAYAPGV       540
     REIVVEPGEE PAPYLAPSGL ELPPIQEPVL TSEANLFDLE ASDLRDVYVW REAQIIEVRR       600
     HVDSHGKERK VRHRLGGSGL WHREPAFWSG VKDAPLKKDA NRKTVKDSEG NPEYEVKPDA       660
     VIVGHGRNGR PRIEEPTENT RKMLDEIEKA KHTDLSRVLV ALSIRHVGPP TAFTLAKHFK       720
     TLDALADASA EELEQIDGIG AEIADSIATF FEEARMPGNW RGRVLEAWKA AGVGMSTHDE       780
     GLPQTLEGKS VVVTGTLEHF SRESAKEAIE RRGGKASGSV SRKTDWVVVG ANPGSKATKA       840
     EELGIPIIDE QQFDTLLATG DVQ                                               863
//

If you have problems or comments...

PBIL Back to PBIL home page