(data stored in ACNUC30630 zone)

EMBL: CP001515.PE671

CP001515.PE671       Location/Qualifiers
FT   CDS             complement(824930..826042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0696"
FT                   /product="hypothetical protein"
FT                   /note="COG0489 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46069"
FT                   /protein_id="ACS46069.1"
FT                   /translation="MTDQTQIIETAVIERLSHVIDPELGRSVTDLGMICGVDVRPTGLD
FT                   SFNVRVNVELTVPGCPLSAEISRQIEAAVTSYAEAQLTAEIVVGAMDEEKLKSLVNDLK
FT                   AARRENPFSKPGTKTRIFAIASGKGGVGKSSISANLAATFAALGYDTAAIDADIYGFSL
FT                   PRLFGVHDQPTNLNGMLMPVTAWGVKLMSIGMFAGSDRAILWRGPRLQRSLEQFLADVW
FT                   WGEPDVLILDLAPGTGDMAISVAQALPNAELVVVTTPQPSASDIAVRSGLVALQVPMRV
FT                   RGVVENMSYFEHAGERIDIFGTGGGARVSSQLTDALHYEVPLMAQLPLDPRIREIGESE
FT                   GRPAVLNDDGTLRDDDFGRTFGHLAKSLLA"
     MTDQTQIIET AVIERLSHVI DPELGRSVTD LGMICGVDVR PTGLDSFNVR VNVELTVPGC        60
     PLSAEISRQI EAAVTSYAEA QLTAEIVVGA MDEEKLKSLV NDLKAARREN PFSKPGTKTR       120
     IFAIASGKGG VGKSSISANL AATFAALGYD TAAIDADIYG FSLPRLFGVH DQPTNLNGML       180
     MPVTAWGVKL MSIGMFAGSD RAILWRGPRL QRSLEQFLAD VWWGEPDVLI LDLAPGTGDM       240
     AISVAQALPN AELVVVTTPQ PSASDIAVRS GLVALQVPMR VRGVVENMSY FEHAGERIDI       300
     FGTGGGARVS SQLTDALHYE VPLMAQLPLD PRIREIGESE GRPAVLNDDG TLRDDDFGRT       360
     FGHLAKSLLA                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page