(data stored in ACNUC30630 zone)

EMBL: CP001515.PE679

CP001515.PE679       Location/Qualifiers
FT   CDS             complement(834793..835233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46077"
FT                   /protein_id="ACS46077.1"
FT                   /translation="MPNGAGYTKPPQNQSNGVYFAPICVSSEGLSDAQSRKLDEDIDEC
FT                   KDLHVSAIDLGHQTQLGNPEFYGDPEVALIDCLHRGNLMPKDYTINKYWLQFEAYMNGT
FT                   KAGSVPDDWFSFDLNDSAMLTCLASDKSPLLQTRLEAWKPFG"
     MPNGAGYTKP PQNQSNGVYF APICVSSEGL SDAQSRKLDE DIDECKDLHV SAIDLGHQTQ        60
     LGNPEFYGDP EVALIDCLHR GNLMPKDYTI NKYWLQFEAY MNGTKAGSVP DDWFSFDLND       120
     SAMLTCLASD KSPLLQTRLE AWKPFG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page