(data stored in ACNUC30630 zone)

EMBL: CP001515.PE685

CP001515.PE685       Location/Qualifiers
FT   CDS             838893..839513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0710"
FT                   /product="Hypothetical membrane protein"
FT                   /note="COG4721 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46083"
FT                   /protein_id="ACS46083.1"
FT                   /translation="MSASVIEAKPVLKWRVVDIAVASVIGVASALIYWFVAFATAAPWS
FT                   LLEGVVPGLAGIFNGLWLFAGPLAAIIVRKPGAALYAEIVAGVLEALMGNMWGGVETFL
FT                   IALVQGLFAEIAFAVFAYKKWNLGVTVLSGALSGVGCWGYSFFTHLQAIDLGGSYGVVY
FT                   LITTVLSGALVAGVAMWYLYLGIARTGALDQFASGRAVRGAKH"
     MSASVIEAKP VLKWRVVDIA VASVIGVASA LIYWFVAFAT AAPWSLLEGV VPGLAGIFNG        60
     LWLFAGPLAA IIVRKPGAAL YAEIVAGVLE ALMGNMWGGV ETFLIALVQG LFAEIAFAVF       120
     AYKKWNLGVT VLSGALSGVG CWGYSFFTHL QAIDLGGSYG VVYLITTVLS GALVAGVAMW       180
     YLYLGIARTG ALDQFASGRA VRGAKH                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page