(data stored in ACNUC30630 zone)

EMBL: CP001515.PE686

CP001515.PE686       Location/Qualifiers
FT   CDS             839554..842109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0711"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46084"
FT                   /protein_id="ACS46084.1"
FT                   /translation="MTTVKSACVEPTTGIALQFDHWGYRHASRKHFAVRGLDLKIHAGE
FT                   HVLLLGASGIGKSTILEGAAGLLGDETGQTDASRVNNAAEGEPPVAVEDADGGITEGAI
FT                   RVGGIEVHAARGKVGLVLQDPDAQAIFQRLGDNVVFGPENLNVPRDLAWQRVDEALNAV
FT                   GLAGVQLDRSVMHLSGGQMQRLALAGALAMRPEVLLLDEPTANLDPDGVVQVVGAVDDV
FT                   LRQTHATMVLVEHRADRWIDMIDRVVVLGLERTDDTRQVGNSGEESEIARTNFRNTVVV
FT                   ADGTPDEVFHNTDIDFNELGIWVPERYRTAEDEITRIHTVDEPEYAPQTGLPEVLLSTK
FT                   ELGIGRDGNAIAEHINLDFHPGQITALVGANGAGKSTLSLTLAGLLKPVEGEVIAHDGL
FT                   AGELDKVWPIDWTSRQLASRISYVFQNPEHQFACSSVLDEVMLGPLRTGMAEEQARARG
FT                   MDLLRRFHLDQYAHVNPYTLSGGEKRRLTVASALASAPKVLLFDEPTFGQDRRTWMQIV
FT                   RLIHDLRSDGVSIVVVTHDRELVTALGARVVELVPTRNPQGLGDDVAATIAARLASPQD
FT                   AVDTTLVPVSQVNERVEEAKPASRSRFLASINPVYRLFGAFLASLPLLASLDWVSASVA
FT                   LGLEFVVLMAIGFTPWRIVRSTWPIFIGAPGSALAVLLYGKSGGDTWWQWGWVNITDRS
FT                   AELALATALRILAIGIPAIIAVLGIDATDLADGFSQILHLPDRFVYGGLAGMRLFSVLQ
FT                   DDWTALTASRRSRGLGDDSAVASFFPQSFALLVLSIRRSTTLAVAMQARGFGGTAPRSH
FT                   ARMSHVHARDYWFLAGCLLIPVIALASAAFAGTFSFMGN"
     MTTVKSACVE PTTGIALQFD HWGYRHASRK HFAVRGLDLK IHAGEHVLLL GASGIGKSTI        60
     LEGAAGLLGD ETGQTDASRV NNAAEGEPPV AVEDADGGIT EGAIRVGGIE VHAARGKVGL       120
     VLQDPDAQAI FQRLGDNVVF GPENLNVPRD LAWQRVDEAL NAVGLAGVQL DRSVMHLSGG       180
     QMQRLALAGA LAMRPEVLLL DEPTANLDPD GVVQVVGAVD DVLRQTHATM VLVEHRADRW       240
     IDMIDRVVVL GLERTDDTRQ VGNSGEESEI ARTNFRNTVV VADGTPDEVF HNTDIDFNEL       300
     GIWVPERYRT AEDEITRIHT VDEPEYAPQT GLPEVLLSTK ELGIGRDGNA IAEHINLDFH       360
     PGQITALVGA NGAGKSTLSL TLAGLLKPVE GEVIAHDGLA GELDKVWPID WTSRQLASRI       420
     SYVFQNPEHQ FACSSVLDEV MLGPLRTGMA EEQARARGMD LLRRFHLDQY AHVNPYTLSG       480
     GEKRRLTVAS ALASAPKVLL FDEPTFGQDR RTWMQIVRLI HDLRSDGVSI VVVTHDRELV       540
     TALGARVVEL VPTRNPQGLG DDVAATIAAR LASPQDAVDT TLVPVSQVNE RVEEAKPASR       600
     SRFLASINPV YRLFGAFLAS LPLLASLDWV SASVALGLEF VVLMAIGFTP WRIVRSTWPI       660
     FIGAPGSALA VLLYGKSGGD TWWQWGWVNI TDRSAELALA TALRILAIGI PAIIAVLGID       720
     ATDLADGFSQ ILHLPDRFVY GGLAGMRLFS VLQDDWTALT ASRRSRGLGD DSAVASFFPQ       780
     SFALLVLSIR RSTTLAVAMQ ARGFGGTAPR SHARMSHVHA RDYWFLAGCL LIPVIALASA       840
     AFAGTFSFMG N                                                            851
//

If you have problems or comments...

PBIL Back to PBIL home page