(data stored in ACNUC30630 zone)

EMBL: CP001515.PE692

CP001515.PE692       Location/Qualifiers
FT   CDS             846842..849433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0717"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /note="COG0073 EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46090"
FT                   /protein_id="ACS46090.1"
FT                   /translation="MGWLREHVAVPENETYEELARDLVRVGLEEEEIHTSNVTGPIVVG
FT                   YVVDATPEPQKNGKVINWCHVDVGEEYNDVDEHGNKVPRGIICGAPNMKAGEKVVVTLP
FT                   GAVLPGNFKIEPRKTYGHISDGMCASERELGLGDSHDGIILLRDYGFTPEEYEALQPGD
FT                   DAMHLLHLDEPILEINVTPDRGYAFSYRGIAREFHNSTGAEFTDPVAAFEERAPQLEDQ
FT                   NGQTHDIDVIIDDDNPIHGVVGCDRFYVRAVHDYKPGSPTPNWMRHRLSRAGMRSLSLP
FT                   VDVTNYVMLDLGQPMHAYDLDKISGPIVVRRAKAGETLVTLDGKKHDLDPEDLLITDSP
FT                   NGEQGSRILGIAGVMGGEYGEVTDETTNILLEAAHFDPITVARSARRHKIPSEASRRFE
FT                   RGVDTQIQPAAAQMAVDLLTKYGDAKASDTPRDVNNVKRGHPIAFKAGEVKRLTSLDLD
FT                   INKISDILTDIGCSVAGGGNGEFSVTAPSWRPDLTAACDLVEEVARIYGYDRIPVRVPH
FT                   APVEGHVGLTDDQLHKRQVADELAEYGLVEVLSYPFVGKADFKNFQIDSEEVEKVSVEI
FT                   VNPLAGDRPFLRRQVLLTLATTVQRNLHRGLENICCYELGHVYLADPEAPAVPALPGAQ
FT                   RPSDDQLSALDAGLPEQPLHVAAILTGNAEDDGWLGDKRPVDWTDAVEAVHRIADRLGA
FT                   KIVLDQSDGDKAGAQWHPGRVARIMSGDTPVGVVGELHPKVDDALGFPRHSAAFEIDLT
FT                   ALFSTLSNKPVQAKPISTFPPVKQDLAFTVPTSVTAHELTETIRQAAGDVLESIELFDV
FT                   YTGDQVGDGKKSLAYAVTFRAPDRTLTSQDSEEIRQRIVEKTATLGAQLRA"
     MGWLREHVAV PENETYEELA RDLVRVGLEE EEIHTSNVTG PIVVGYVVDA TPEPQKNGKV        60
     INWCHVDVGE EYNDVDEHGN KVPRGIICGA PNMKAGEKVV VTLPGAVLPG NFKIEPRKTY       120
     GHISDGMCAS ERELGLGDSH DGIILLRDYG FTPEEYEALQ PGDDAMHLLH LDEPILEINV       180
     TPDRGYAFSY RGIAREFHNS TGAEFTDPVA AFEERAPQLE DQNGQTHDID VIIDDDNPIH       240
     GVVGCDRFYV RAVHDYKPGS PTPNWMRHRL SRAGMRSLSL PVDVTNYVML DLGQPMHAYD       300
     LDKISGPIVV RRAKAGETLV TLDGKKHDLD PEDLLITDSP NGEQGSRILG IAGVMGGEYG       360
     EVTDETTNIL LEAAHFDPIT VARSARRHKI PSEASRRFER GVDTQIQPAA AQMAVDLLTK       420
     YGDAKASDTP RDVNNVKRGH PIAFKAGEVK RLTSLDLDIN KISDILTDIG CSVAGGGNGE       480
     FSVTAPSWRP DLTAACDLVE EVARIYGYDR IPVRVPHAPV EGHVGLTDDQ LHKRQVADEL       540
     AEYGLVEVLS YPFVGKADFK NFQIDSEEVE KVSVEIVNPL AGDRPFLRRQ VLLTLATTVQ       600
     RNLHRGLENI CCYELGHVYL ADPEAPAVPA LPGAQRPSDD QLSALDAGLP EQPLHVAAIL       660
     TGNAEDDGWL GDKRPVDWTD AVEAVHRIAD RLGAKIVLDQ SDGDKAGAQW HPGRVARIMS       720
     GDTPVGVVGE LHPKVDDALG FPRHSAAFEI DLTALFSTLS NKPVQAKPIS TFPPVKQDLA       780
     FTVPTSVTAH ELTETIRQAA GDVLESIELF DVYTGDQVGD GKKSLAYAVT FRAPDRTLTS       840
     QDSEEIRQRI VEKTATLGAQ LRA                                               863
//

If you have problems or comments...

PBIL Back to PBIL home page