(data stored in ACNUC30630 zone)

EMBL: CP001515.PE719

CP001515.PE719       Location/Qualifiers
FT   CDS             879151..879555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0745"
FT                   /product="hypothetical protein"
FT                   /note="COG0799 Uncharacterized homolog of plant Iojap
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46117"
FT                   /protein_id="ACS46117.1"
FT                   /translation="MEQSINSVRVAATAADGMKAEDVVAYNVGDKLGICDLMMIASASN
FT                   ERQVLAIAEEVEKQLFLKDGGRKPRSREGVEEAQWVLLDYGDFIIHIMHDEARDFYNLE
FT                   RLWRDCEPVDLELEHPESRGIKSSDADTEE"
     MEQSINSVRV AATAADGMKA EDVVAYNVGD KLGICDLMMI ASASNERQVL AIAEEVEKQL        60
     FLKDGGRKPR SREGVEEAQW VLLDYGDFII HIMHDEARDF YNLERLWRDC EPVDLELEHP       120
     ESRGIKSSDA DTEE                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page