(data stored in ACNUC30630 zone)

EMBL: CP001515.PE722

CP001515.PE722       Location/Qualifiers
FT   CDS             881751..882155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0750"
FT                   /product="hypothetical protein"
FT                   /note="COG3576 Predicted flavin-nucleotide-binding protein
FT                   structurally related to pyridoxine 5-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46120"
FT                   /protein_id="ACS46120.1"
FT                   /translation="MAQLTEDMKEFIKNNLAWVATVNQDGIPDLGPKMSMFVLDDNHLA
FT                   YHERTAGQTYRNLENGSPLVVAFANFEQKKGYRFRGEVVLHTDDAIYDEQVKLANERGT
FT                   KVPACVPVLEISEIEDLSAGAKAGTVISHD"
     MAQLTEDMKE FIKNNLAWVA TVNQDGIPDL GPKMSMFVLD DNHLAYHERT AGQTYRNLEN        60
     GSPLVVAFAN FEQKKGYRFR GEVVLHTDDA IYDEQVKLAN ERGTKVPACV PVLEISEIED       120
     LSAGAKAGTV ISHD                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page