(data stored in ACNUC30630 zone)

EMBL: CP001515.PE728

CP001515.PE728       Location/Qualifiers
FT   CDS             888990..890756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0756"
FT                   /product="ComA-like putative transmembrane protein"
FT                   /note="COG0658 Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46126"
FT                   /protein_id="ACS46126.1"
FT                   /translation="MGMRAMTAPACDREHRGIAGSRDLRMLPVAAGVWSATLLTRWVCS
FT                   QHGSGHDVFWQHGRMLQMACLAVASAAIFIALVLIPLTMNGAGKHHGLAVDRAHRMLYT
FT                   LLTVCFAILAATLATAARSLTEHADPVNMSASSSTERVNLTFTAHSLPLATSMGGYDCQ
FT                   VDGNARSIVRHDVRRPSSRGVRVFARQPACGRIAQQGDYAIVGTIQAAAYGEMPIWVLA
FT                   DGDMMAVKEPPAPWRAVHRIRMAFLQTTRGLDNPGVVLVPGVTLGVLGHDAMVHCADGG
FT                   VEDEYAELLQEQCRRAGIMHLMAVSGGHYALVGTLVMGLGARLHWNRFVKAGALAMVYP
FT                   MLTMVLAPSRSVTRAMLMSMLSLGFLMLGRRRQSVHLLCLTVVFGLLLDPSLASSYGFA
FT                   LSCAAVFGLSTACTRMTAWVSHLLPDRLAKLLAASCCAQLFAGPVQILMDNEVSIWSLP
FT                   ANLLVAPFVDAATILGLCSLFVAWMAPGVSRFLAWACSQCTTVIEYAARLFGSEESSTL
FT                   AWMEGIPGAAVLIVTELTTWALIVCIGDLLRAYDDTVTNGDGRPMRMPVRERLTQWFEH
FT                   TLEMMGWLTWRR"
     MGMRAMTAPA CDREHRGIAG SRDLRMLPVA AGVWSATLLT RWVCSQHGSG HDVFWQHGRM        60
     LQMACLAVAS AAIFIALVLI PLTMNGAGKH HGLAVDRAHR MLYTLLTVCF AILAATLATA       120
     ARSLTEHADP VNMSASSSTE RVNLTFTAHS LPLATSMGGY DCQVDGNARS IVRHDVRRPS       180
     SRGVRVFARQ PACGRIAQQG DYAIVGTIQA AAYGEMPIWV LADGDMMAVK EPPAPWRAVH       240
     RIRMAFLQTT RGLDNPGVVL VPGVTLGVLG HDAMVHCADG GVEDEYAELL QEQCRRAGIM       300
     HLMAVSGGHY ALVGTLVMGL GARLHWNRFV KAGALAMVYP MLTMVLAPSR SVTRAMLMSM       360
     LSLGFLMLGR RRQSVHLLCL TVVFGLLLDP SLASSYGFAL SCAAVFGLST ACTRMTAWVS       420
     HLLPDRLAKL LAASCCAQLF AGPVQILMDN EVSIWSLPAN LLVAPFVDAA TILGLCSLFV       480
     AWMAPGVSRF LAWACSQCTT VIEYAARLFG SEESSTLAWM EGIPGAAVLI VTELTTWALI       540
     VCIGDLLRAY DDTVTNGDGR PMRMPVRERL TQWFEHTLEM MGWLTWRR                    588
//

If you have problems or comments...

PBIL Back to PBIL home page