(data stored in ACNUC30630 zone)

EMBL: CP001515.PE73

CP001515.PE73        Location/Qualifiers
FT   CDS             complement(82389..82772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45471"
FT                   /protein_id="ACS45471.1"
FT                   /translation="MMRGMQAYDDWCTAARAAAETTPALDIAPRLDRATMAMAVRYSLH
FT                   QLEIKAPGPGVEVRVAPYAVVKILEGPASDPHNLTPPDVIELDPQVWLRVASGITTWHE
FT                   EQKAGRISAVGERDDLSPLLPLG"
     MMRGMQAYDD WCTAARAAAE TTPALDIAPR LDRATMAMAV RYSLHQLEIK APGPGVEVRV        60
     APYAVVKILE GPASDPHNLT PPDVIELDPQ VWLRVASGIT TWHEEQKAGR ISAVGERDDL       120
     SPLLPLG                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page