(data stored in ACNUC30630 zone)

EMBL: CP001515.PE731

CP001515.PE731       Location/Qualifiers
FT   CDS             892486..893328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0759"
FT                   /product="hypothetical protein"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46129"
FT                   /protein_id="ACS46129.1"
FT                   /translation="MNTLVIDTSFGSTVGITGHEPICEQDSRTHVEKLQHDIAQVCAEA
FT                   KIQPHDIERIVVGIGPAPFTGLRAGIVAAKAIAYATGAQLLGQDSLSGQAAMMQAAYNG
FT                   DPNLLNTAIFGNWNTPANAGTALHLTLSVNDARRKQLYYTLLANTNADTKDERIQLDMN
FT                   IGTPSNIAAKVSAAVATIQQRHPDQPVAVDIVGHGASKYEQIWSEQPWHGITLDHSLLD
FT                   TGAWGVKTFAALAEHDTEADANPRPIEPLYLRRPDVSVPNPLKHVLNHEGAHRNEANA"
     MNTLVIDTSF GSTVGITGHE PICEQDSRTH VEKLQHDIAQ VCAEAKIQPH DIERIVVGIG        60
     PAPFTGLRAG IVAAKAIAYA TGAQLLGQDS LSGQAAMMQA AYNGDPNLLN TAIFGNWNTP       120
     ANAGTALHLT LSVNDARRKQ LYYTLLANTN ADTKDERIQL DMNIGTPSNI AAKVSAAVAT       180
     IQQRHPDQPV AVDIVGHGAS KYEQIWSEQP WHGITLDHSL LDTGAWGVKT FAALAEHDTE       240
     ADANPRPIEP LYLRRPDVSV PNPLKHVLNH EGAHRNEANA                             280
//

If you have problems or comments...

PBIL Back to PBIL home page