(data stored in ACNUC30630 zone)

EMBL: CP001515.PE748

CP001515.PE748       Location/Qualifiers
FT   CDS             909368..910564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0778"
FT                   /product="hypothetical protein"
FT                   /note="COG0820 Predicted Fe-S-cluster redox enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46146"
FT                   /protein_id="ACS46146.1"
FT                   /translation="MSDFRVTDDNQVSETVETGITEGGRSGAFRDVLSKNHARRGKPPV
FT                   HFADLTDDERIAKAKELGLPKFRVRQLANHYYGHFDADAGYFTDFPAGKRDEVAREFFP
FT                   TLIREVTRQVADDGQTIKTLWELFDGSKIESVLMRYPNRTTLCISSQVGCGMGCPFCAT
FT                   GQLGLTRNMSTGEILEQVRIAAAMMERGEVAGGPGRLSNVVFMGMGEPMGNYRAIVSAV
FT                   RQISAMPPEGFGISARNITVSTVGVVPGIRRLAQEGMPVRLAVSLHAPNNALRDELVPM
FT                   NRRFNVDEVLDAAHDYYLASKRRVSIEYALMRGINDQEIHARQLANRLNHYGDNWAHVN
FT                   PIPLNPIEGSKWTASKPEDERRFLEILHNAGITATLRDTRGQDIDGACGQLAAKTNNA"
     MSDFRVTDDN QVSETVETGI TEGGRSGAFR DVLSKNHARR GKPPVHFADL TDDERIAKAK        60
     ELGLPKFRVR QLANHYYGHF DADAGYFTDF PAGKRDEVAR EFFPTLIREV TRQVADDGQT       120
     IKTLWELFDG SKIESVLMRY PNRTTLCISS QVGCGMGCPF CATGQLGLTR NMSTGEILEQ       180
     VRIAAAMMER GEVAGGPGRL SNVVFMGMGE PMGNYRAIVS AVRQISAMPP EGFGISARNI       240
     TVSTVGVVPG IRRLAQEGMP VRLAVSLHAP NNALRDELVP MNRRFNVDEV LDAAHDYYLA       300
     SKRRVSIEYA LMRGINDQEI HARQLANRLN HYGDNWAHVN PIPLNPIEGS KWTASKPEDE       360
     RRFLEILHNA GITATLRDTR GQDIDGACGQ LAAKTNNA                               398
//

If you have problems or comments...

PBIL Back to PBIL home page