(data stored in ACNUC30630 zone)

EMBL: CP001515.PE766

CP001515.PE766       Location/Qualifiers
FT   CDS             925113..925445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0796"
FT                   /product="hypothetical protein"
FT                   /note="COG3856 Uncharacterized conserved protein (small
FT                   basic protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46164"
FT                   /protein_id="ACS46164.1"
FT                   /translation="MAAVLGLIIGVVVGLFVKPDIPIWLQPYLPIMVVAALDALLGAAR
FT                   AYFERSFSDKVFVISFFSNVVTATLLVLLGNQLGVGSQLSTAVIVVLGIRIFSNVSAIR
FT                   RFIFQG"
     MAAVLGLIIG VVVGLFVKPD IPIWLQPYLP IMVVAALDAL LGAARAYFER SFSDKVFVIS        60
     FFSNVVTATL LVLLGNQLGV GSQLSTAVIV VLGIRIFSNV SAIRRFIFQG                  110
//

If you have problems or comments...

PBIL Back to PBIL home page