(data stored in ACNUC30630 zone)

EMBL: CP001515.PE80

CP001515.PE80        Location/Qualifiers
FT   CDS             91567..92721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0082"
FT                   /product="hypothetical protein"
FT                   /note="COG3764 Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45478"
FT                   /protein_id="ACS45478.1"
FT                   /translation="MKHGGRRGNASARQDGRIDRLPEVGGKRSVMRSVVMILAEILLTV
FT                   GLVCALYVVWMQWWTGVQSENRQIEERQSVGWAQPASDGANAKIAHPQQGDPPLQPEHA
FT                   SIGELIGRVYIPRFGDAWERNLVQGTDLAELNLHGLGHYVDSQMPGQVGNFAIAGHRNG
FT                   YGQPLGDVDKLQPGDAVVVRTKDYWYVYTYTNYTIVTPDETSVISANPEDPSAPPTKRL
FT                   LTMTTCEPKYTAPTHRWISFGEFKYWAKVSDGVPAELAKKGADGATKFISNEQTPFFAK
FT                   LKTLQPVIWGALIAYAIIFIAAAIAWRWPLLRAIREGRRPRPDVDIYGVLVRHQPGPAP
FT                   IRWLLALLLFVAVSLAIIEWACPWAASHIEILREMSNYTAVNTQ"
     MKHGGRRGNA SARQDGRIDR LPEVGGKRSV MRSVVMILAE ILLTVGLVCA LYVVWMQWWT        60
     GVQSENRQIE ERQSVGWAQP ASDGANAKIA HPQQGDPPLQ PEHASIGELI GRVYIPRFGD       120
     AWERNLVQGT DLAELNLHGL GHYVDSQMPG QVGNFAIAGH RNGYGQPLGD VDKLQPGDAV       180
     VVRTKDYWYV YTYTNYTIVT PDETSVISAN PEDPSAPPTK RLLTMTTCEP KYTAPTHRWI       240
     SFGEFKYWAK VSDGVPAELA KKGADGATKF ISNEQTPFFA KLKTLQPVIW GALIAYAIIF       300
     IAAAIAWRWP LLRAIREGRR PRPDVDIYGV LVRHQPGPAP IRWLLALLLF VAVSLAIIEW       360
     ACPWAASHIE ILREMSNYTA VNTQ                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page